PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g088010.1
Common NameMTR_5g088010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 250aa    MW: 28008.7 Da    PI: 6.0992
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g088010.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-1562105447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT +E++l++++ k++G+g+Wk I++++  ++t+ q+ s+ qky
  Medtr5g088010.1  62 WTDDEHKLFLKGLKKHGKGRWKDISKEFVVTKTPTQIASHAQKY 105
                      *******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17954110IPR017930Myb domain
SuperFamilySSF466897.11E-1755110IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-1658109IPR006447Myb domain, plants
SMARTSM007173.5E-958108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-1061104IPR009057Homeodomain-like
CDDcd001678.37E-1162106No hitNo description
PfamPF002493.7E-1362105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEQQQEKTGT DIIESGGAVA ILNSNDNNVA TLNSDENNLI QAESGPEESH PPGRVQRKSI  60
HWTDDEHKLF LKGLKKHGKG RWKDISKEFV VTKTPTQIAS HAQKYFIHQN VKDIEKKEKK  120
RKSIHDTTLN KNDTLVTVAV EQRDEIPSVE LQSVIPPQGM QQTQTQQNEI SPMLCLLPIS  180
STIPSVQQQN ELTPVVTAPM EQQHETPAIL NNKDNENLQT QLVLLYPIGS TLPDMNKLEK  240
MCNLLAKEL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1249720.0AC124972.41 Medicago truncatula clone mth2-24j4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617111.20.0MYB-like DNA-binding domain, shaqkyf class protein
TrEMBLG7K3050.0G7K305_MEDTR; MYB-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1691138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.19e-14MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]